PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G008000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 390aa    MW: 40700.6 Da    PI: 6.5046
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G008000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.32e-191562148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd+llvd+++++G g+W++ ++  g++R++k+c++rw +yl
  Sobic.010G008000.1.p 15 KGPWTPEEDKLLVDYINEHGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62
                          79********************************************97 PP

2Myb_DNA-binding56.75.6e-1868113148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rgr+T +E++l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
  Sobic.010G008000.1.p  68 RGRFTDDEEKLIIHLHSLLGNK-WSSIATKLP-GRTDNEIKNYWNTHL 113
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.6171062IPR017930Myb domain
SuperFamilySSF466895.14E-3112109IPR009057Homeodomain-like
SMARTSM007176.6E-161464IPR001005SANT/Myb domain
PfamPF002496.9E-181562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-241669IPR009057Homeodomain-like
CDDcd001671.01E-121762No hitNo description
PROSITE profilePS5129427.69263117IPR017930Myb domain
SMARTSM007171.4E-1667115IPR001005SANT/Myb domain
PfamPF002492.7E-1668113IPR001005SANT/Myb domain
CDDcd001671.26E-1270113No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2670117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MGRSPCCDQD AGVKKGPWTP EEDKLLVDYI NEHGHGSWRR LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGR FTDDEEKLII HLHSLLGNKW SSIATKLPGR TDNEIKNYWN THLRKKLLSM  120
GIDPVTHQRR TDLNLLAAGG FTNLLAAANL AAAAGGGGPA GTGPLAAAAQ ASCWDINALR  180
LQADAAKYQL LEGLVRVLTA PAAPTVDLMT LLAAANGGGA VSGGHHHQLL SGVDQQSTTT  240
ASRVVQQYDG MLSLPALTSV PAAVTTTQGM SSSAYSLSGL LNSFGGAGTT TNALAGDGLS  300
STELGHSGAT TGSNITAAAM PPPLAPAAEG CNAGNGVGTS STPSPCEETP ASSPFDGLDS  360
LTLDFDPNSD SWRELLEQMS WLNNPNDQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276650.0KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659377.10.0PREDICTED: uncharacterized protein LOC103638172
SwissprotQ8GWP03e-79MYB39_ARATH; Transcription factor MYB39
TrEMBLK7V7T90.0K7V7T9_MAIZE; MYB transcription factor
STRINGGRMZM2G044824_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55293158
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.17e-78myb domain protein 93